PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02904.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 140aa    MW: 15135.1 Da    PI: 8.4138
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02904.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.45.3e-2561112253
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   CqvegC  dl+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  l 
  Zmw_sc02904.1.g00120.1.am.mk  61 CQVEGCGLDLTGAKEYHRKHRVCEAHTKCPRVVVAGHERRFCQQCSRWVWLP 112
                                   ***********************************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-2454108IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.13658135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-2459113IPR004333Transcription factor, SBP-box
PfamPF031106.7E-1961108IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MEWTVPKPAA SPSSQPLLWD WGDSATPASG SSGEAPARRG GREREGKRAK GEDGGAGEVK  60
CQVEGCGLDL TGAKEYHRKH RVCEAHTKCP RVVVAGHERR FCQQCSRWVW LPDLLLSISR  120
MSSAVDLVDC RAASSRASCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A4e-1559114459squamosa promoter-binding protein-like 12
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.12e-58PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ6H5098e-34SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLK3YU032e-58K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m6e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952